A practical reference on research chemical: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2025-07-24 and is reviewed periodically as new material appears.
Most published work on SR9009 consists of preclinical studies. It is widely sold as a research chemical, a category that does not imply safety, efficacy, or pharmaceutical-grade quality. Sports anti-doping organizations have listed SR9009 as a prohibited substance, and its presence in an athlete sample can lead to sanctions. Legal status differs by country; in several jurisdictions it is not approved for human consumption and may be treated as an unapproved new drug.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is not a steroid, peptide, or natural hormone. In scientific literature, it appears under the code SR9009 and in non-scientific contexts as Stenabolic. The compound was identified through chemical screening efforts aimed at targeting circadian clock components. Its status remains investigational, and no regulatory agency has approved it as a human medicine.
SR9009 stability depends on temperature, moisture, light, and solvent. Solid material is generally kept cool and dry, while solutions may require protection from repeated warming and cooling. Degradation can appear as color changes, precipitate, or new chromatographic peaks. Researchers should follow supplier instructions and their own stability data. Long-term storage conditions for human use have not been established because the compound lacks approved clinical formulation.
SR9009 is supplied as a solid research chemical, often in milligram quantities. Laboratories typically weigh it in a controlled environment because fine powders can disperse. Stock solutions are commonly prepared in dimethyl sulfoxide and stored in small aliquots to reduce freeze-thaw cycles. Personal protective equipment and chemical fume hoods are standard when handling unknown or potent compounds. These practices address laboratory safety rather than human use.
Identity and purity of SR9009 samples are usually checked with chromatographic and spectrometric methods. High-performance liquid chromatography can separate the compound from related impurities, while mass spectrometry provides molecular mass confirmation. Nuclear magnetic resonance spectroscopy may be used for structural verification in research settings. No single method proves biological activity, and certificates of analysis should be reviewed alongside raw data. Independent testing is often needed because online products vary widely.
| Property | Value | Notes |
|---|---|---|
| Common name | SR9009 | Also referred to as Stenabolic in non-scientific contexts. |
| Chemical class | Synthetic small molecule | Not a steroid or peptide hormone. |
| Receptor target | REV-ERBα and REV-ERBβ | Nuclear receptor agonist in preclinical studies. |
| Development status | Investigational | No approved human therapeutic indication. |
| Regulatory attention | Prohibited in sport | Listed by anti-doping authorities. |
Storage conditions for research-grade SR9009 generally involve a freezer at approximately minus twenty degrees Celsius, sometimes lower for long-term preservation. Containers should remain tightly closed and protected from light. Desiccants may be used to limit moisture uptake. Solutions are often stored in aliquots to avoid repeated warming and cooling. Stability data for the compound under various conditions are limited, so laboratories typically follow supplier recommendations and verify performance through periodic analytical checks rather than assuming indefinite stability.
Identity and purity testing for SR9009 commonly uses liquid chromatography coupled with tandem mass spectrometry. This method separates the compound from matrix components and detects it by mass-to-charge transitions, providing sensitive and specific confirmation. Nuclear magnetic resonance spectroscopy can support structural identification, while high-performance liquid chromatography with ultraviolet detection may estimate purity. Because online products labeled as SR9009 may contain other substances or no active compound at all, independent verification is important in research settings. Certificates of analysis are useful but not a substitute for in-house testing.
Laboratory samples of SR9009 are typically supplied as a white to off-white powder. The compound dissolves readily in organic solvents such as dimethyl sulfoxide and ethanol, while its solubility in water is low. Because of this solubility profile, researchers often prepare concentrated stock solutions in an organic solvent before diluting them into aqueous assay buffers. Light exposure, moisture, and repeated freeze-thaw cycles can degrade many small molecules, so handling procedures usually aim to minimize these factors. Purity is commonly checked before use.
SR9009 is often grouped with compounds studied for circadian and metabolic regulation rather than with classical anabolic steroids. Its interactions with nuclear receptors differ from those of androgen receptor ligands, and its proposed mechanisms involve transcriptional control rather than direct hormone signaling. Some sources classify it as a metabolic modulator because of observed effects on energy utilization. The distinction matters for regulation and for interpreting research results across different compound classes.
SR9009 is a synthetic small molecule developed as a REV-ERB agonist. It binds to REV-ERBα and REV-ERBβ, nuclear receptors that help regulate circadian rhythms and metabolic gene expression. In cell and animal studies, the compound alters lipid and glucose handling and influences skeletal muscle oxidative capacity. Its exact effects in humans remain largely uncharacterized because controlled clinical trials have not been reported. The molecule is frequently described in preclinical literature as a metabolic modulator.
Physicochemical behavior influences handling. SR9009 is described as a solid with limited aqueous solubility, so organic solvents such as dimethyl sulfoxide or ethanol are common in research stock solutions. Aqueous dilution can produce precipitates if the organic content is too low. Light, heat, and repeated freeze-thaw cycles may affect stability. Storage recommendations usually specify a desiccated freezer environment protected from light, but exact stability data depend on the formulation and matrix.
Detection in biological samples can be complicated by rapid metabolism and low circulating concentrations. Some studies report phase I and phase II metabolites, and analytical methods may need to target those species in addition to the parent compound. Immunoassays are not broadly available, so mass spectrometry remains the main confirmatory approach. For anti-doping testing, laboratories look for SR9009 and its metabolites using validated LC-MS methods. Open questions include how long metabolites remain detectable and how different routes of administration alter detection windows.
Thus, a high ratio of [NADH] to [NAD+] or a high ratio of [ADP] [Pi] to [ATP] imply a high amount of reduced cytochrome c and a high level of cytochrome c oxidase activity. An additional level of regulation is introduced by the transport rates of ATP and NADH between the mitochondrial matrix and the cytoplasm.
1.0 L PC, 45 PS (33 kW; 44 hp) / 51 lb⋅ft (69 N⋅m) – export only 1.3 L TC (1977.01–1980) 60 PS (44 kW; 59 hp) / 72 PS (53 kW) in Japan 1.4 L UC (1978.03–1980) 83 PS (61 kW) in Japan In Australia the 1.3 had 45 kW (61 PS; 60 hp) at 5700 rpm while the bigger 1.4, introduced in July 1978, offered 48 kW (65 PS; 64 hp) at a somewhat lower engine speed of 5500 rpm. The 1.4 was accompanied by the new, better-equipped CS model which was only available with five-door bodywork. Van engines:
Some manufacturers are also trying to improve on the traditional design by altering properties within these machines other than the pressure driving the sample through the orifice. One such example is Constant Systems, who have recently shown that their Cell Disruptors not only match the performance of a traditional French Press, but also that they are striving towards attaining the same results at a much lower power. Pressure Cycling Technology ("PCT"). PCT is a patented, enabling technology platform that uses alternating cycles of hydrostatic pressure between ambient and ultra-high levels (up to 90,000 psi) to safely, conveniently and reproducibly control the actions of molecules in biological samples, e.g., the rupture (lysis) of cells and tissues from human, animal, plant, and microbial sources, and the inactivation of pathogens. PCT-enhanced systems (instruments and consumables) address some challenging problems inherent in biological sample preparation. PCT advantages include: (a) extraction and recovery of more membrane proteins, (b) enhanced protein digestion, (c) differential lysis in a mixed sample base, (d) pathogen inactivation, (e) increased DNA detection, and (f) exquisite sample preparation process control. The Microfluidizer method used for cell disruption strongly influences the physicochemical properties of the lysed cell suspension, such as particle size, viscosity, protein yield and enzyme activity.
After two years, the inquiry concluded with three principal findings and several recommendations, including required training for administrators, directors of nursing, and service organizations, improved screening processes and background checks for new hires, minimizing the use of agency nurses in long-term care homes, improved reporting processes for critical incidents, and changes to certain Ontario provincial regulations.
=== Platelet-rich plasma (PRP) === Using ones own cells and tissues and without harsh side effects, PRP is beneficial for alopecia areata and androgenetic alopecia and can be used as an alternative to minoxidil or finasteride. It has been documented to improve hair density and thickness in both genders. A minimum of 3 treatments, once a month for 3 months are recommended, and afterwards a 3-6 month period of continual appointments for maintenance. Factors that determine efficacy include amount of sessions, double versus single centrifugation, age and gender, and where the PRP is inserted. Future larger randomized controlled trials and other high quality studies are still recommended to be carried out and published for a stronger consensus. Further development of a standardized practice for procedure is also recommended.
Sources: en.wikipedia.org
It is now known that organic compounds can be conductors, semiconductors, and insulators, thus one of the main opportunities in nanomaterials science is to use organic synthesis and molecular design to make electronically useful structures. Structural motifs in these systems include colloids, small crystals, and aggregates on the order of 1-100 nm. By function Nanostructured materials can also be classed according to their functions, for example nanoelectronics and information technology (IT). Lateral dimensions used in information storage are shrinking from the micro- to the nanoscale as fabrication technologies improve. Optical materials are important in the development of miniaturized information storage because light has many advantages for storage and transmission over electronic methods. Quantum dots - most commonly CdSe nanoparticles having diameters of tens of nm, and with protective surface coatings - are notable for their ability to fluoresce over a broad range of the visible spectrum, with the controlling parameter being size. By structure Certain structural classes are especially relevant to nanoscience. As the dimensions of structures become smaller, their surface area-to-volume ratio increases. Much like molecules, nanostructures at small enough scales are essentially "all surface". The mechanical properties of materials are strongly influenced by these surface structures. Fracture strength and character, ductility, and various mechanical moduli all depend on the substructure of the materials over a range of scales.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
== Function == The Min proteins prevent the FtsZ ring from being placed anywhere but near the mid cell and are hypothesized to be involved in a spatial regulatory mechanism that links size increases prior to cell division to FtsZ polymerization in the middle of the cell.
In 2021, the average annual salary in the private sector was €18,630 for women and €24,640 for men, reflecting a 24.4% gap. This difference is partially attributed to variations in working hours, job types, and the prevalence of part-time work, which accounted for approximately 40% of the wage gap in 2017. When adjusted to full-time equivalents, the average wage gap was 15.5% in 2021, down from 17.5% in 2016. The wage gap tends to increase with age: it was 4.6% at age 25 and rose to 27.5% among those over 60. Differences in working time decrease with age, from 20% under age 25 to 10% between ages 25 and 60. For workers, women earned 14.3% less than men for equivalent hours and worked 23.3% fewer hours. Among employees, women earned 4.7% less for similar hours and had nearly equal working time. The pay gap for equal hours was 16.1% among executives and 12.2% among intermediate professions, with women in these groups also working fewer hours (4.7% and 10.9%, respectively). For equivalent positions and working hours, the wage gap was 4.3%, though occupational segregation—such as differences in sector and employer—affects this figure. In the public sector, the overall gender wage gap was 14%. Among executives, the gap was 23%; among workers, 17%; and among employees, 7%. For full-time salaried positions, the gender wage gap declined from 29.4% in 1976 to 16.3% in 2017. The gap narrowed steadily until 1980, remained largely stable until 2000, and began to decrease again thereafter, though part-time employment among women influenced this trend.
Sources: en.wikipedia.org
The 2013 Cochrane Collaboration review (updated in 2026) on physical exercise for depression noted that, based upon limited evidence, it is moderately more effective than a control intervention and comparable to psychological or antidepressant drug therapies. Smaller effects were seen in more methodologically rigorous studies. Three subsequent 2014 systematic reviews that included the Cochrane review in their analysis concluded with similar findings: one indicated that physical exercise is effective as an adjunct treatment with antidepressant medication; the other two indicated that physical exercise has marked antidepressant effects and recommended the inclusion of physical activity as an adjunct treatment for mild–moderate depression and mental illness in general. These studies also found smaller effect sizes in more methodologically rigorous studies. All four systematic reviews called for more research in order to determine the efficacy or optimal exercise intensity, duration, and modality. A 2025 systematic review on the effectiveness of rock climbing for depression reported that indoor bouldering combined with mindfulness exercises may be an effective, clinically meaningful, safe, and sustainable adjunctive intervention for adults with moderate depression. However, the review found insufficient data to determine whether it was superior to other established treatments.
=== Stabilization === Material treated with plastic or water glass is termed "bonded" or "stabilized" turquoise. This process consists of pressure impregnation of otherwise unsaleable chalky American material by epoxy and plastics (such as polystyrene) and water glass (sodium silicate) to produce a wetting effect and improve durability. Plastic and water glass treatments are far more permanent and stable than waxing and oiling, and can be applied to material too chemically or physically unstable for oil or wax to provide sufficient improvement. Conversely, stabilization and bonding are rejected by some as too radical an alteration. The epoxy binding technique was first developed in the 1950s and has been attributed to Colbaugh Processing of Arizona, a company that still operates today.
According to the nomenclature recommended by IUPAC, salts are named according to their composition, not their structure. In the most simple case of a binary salt with no possible ambiguity about the charges and thus the stoichiometry, the common name is written using two words. The name of the cation (the unmodified element name for monatomic cations) comes first, followed by the name of the anion. For example, MgCl2 is named magnesium chloride, and Na2SO4 is named sodium sulfate (SO2−4, sulfate, is an example of a polyatomic ion). To obtain the empirical formula from these names, the stoichiometry can be deduced from the charges on the ions, and the requirement of overall charge neutrality. If there are multiple different cations and/or anions, multiplicative prefixes (di-, tri-, tetra-, ...) are often required to indicate the relative compositions, and cations then anions are listed in alphabetical order. For example, KMgCl3 is named magnesium potassium trichloride to distinguish it from K2MgCl4, magnesium dipotassium tetrachloride (note that in both the empirical formula and the written name, the cations appear in alphabetical order, but the order varies between them because the symbol for potassium is K). When one of the ions already has a multiplicative prefix within its name, the alternate multiplicative prefixes (bis-, tris-, tetrakis-, ...) are used. For example, Ba(BrF4)2 is named barium bis(tetrafluoridobromate).
This was important for the introduction of new emergency acts: the grand coalition gave the ruling parties the two-thirds majority of votes required for their ratification. These controversial acts allowed basic constitutional rights such as freedom of movement to be limited in case of a state of emergency.
=== Middle Eastern culture === The scorpion is a culturally significant animal, appearing as a motif in art, especially in Islamic art in the Middle East. A scorpion motif is often woven into Turkish kilim flat-weave carpets, for protection from their sting. The scorpion is perceived both as an embodiment of evil and a protective force such as a dervish's powers to combat evil. In another context, the scorpion portrays human sexuality. Scorpions are used in folk medicine in South Asia, especially in antidotes for scorpion stings. One of the earliest occurrences of the scorpion in culture is its inclusion, as Scorpio, in the 12 signs of the Zodiac by Babylonian astronomers during the Chaldean period. In ancient Egypt, the goddess Serket was often depicted as a scorpion, one of several goddesses who protected the Pharaoh. Alongside serpents, scorpions are used to symbolize evil in the New Testament. In Luke 10:19 it is written, "Behold, I give unto you power to tread on serpents and scorpions, and over all the power of the enemy: and nothing shall by any means hurt you." Here, scorpions and serpents symbolize evil. Revelation 9:3 speaks of "the power of the scorpions of the earth."
Sources: en.wikipedia.org
It is a synthetic compound studied as an agonist of REV-ERB nuclear receptors. It is not an approved medicine and has mainly been examined in laboratory and animal research.
No. It is a small molecule that binds nuclear receptors involved in circadian regulation. Its classification differs from anabolic steroids or peptide hormones.
Published human clinical trial data are lacking. Most safety and activity information comes from preclinical models, so effects in people remain uncertain.
Laboratories commonly use liquid chromatography coupled with mass spectrometry to detect SR9009. The method can identify the compound and estimate concentration in a sample. Detection limits depend on the matrix and instrument.